SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182KNI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182KNI9
Domain Number 1 Region: 165-286
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000916
Family Insect pheromone/odorant-binding proteins 0.0061
Further Details:      
 
Domain Number 2 Region: 28-90
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000942
Family Insect pheromone/odorant-binding proteins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182KNI9
Sequence length 335
Comment (tr|A0A182KNI9|A0A182KNI9_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACOM024401-PA} KW=Complete proteome; Reference proteome OX=1518534 OS=Anopheles coluzzii. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MIVAPVVLSIFLQLFVQAAQPWKALDPEQALYVYKRCYEDHLPAGSSRVTYLKSWNAWKL
EPNDAVTHCYAKCVLIGLQLYEEKDKAFKSERIPVQHEAYKTLNEANSREVTEYQQALAS
INAGDGSCVALYNAYLPVHNKFVDLSRKLYHGTVEGAAKIYAAMPQIKQKGESFFAYCAK
KIWGGYNKKEWKRGRNYELSGSSQFKKVIDCIFRGLRYMDDSGLKVICFTTSNEKLCIVS
VIQLQVDEVVRDFNLINKSDLEPEVRSVLASCTGTQAYDYYSCLLNSPVKEDFKNAFDFH
ELRSADYAFLLRGKVYEGPEQVKEEMKHLNTTVHF
Download sequence
Identical sequences A0A182KNI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]