SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182L956 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A182L956
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00628
Family AN1-like Zinc finger 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182L956
Sequence length 180
Comment (tr|A0A182L956|A0A182L956_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACOM034109-PA} KW=Complete proteome; Reference proteome OX=1518534 OS=Anopheles coluzzii. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVKTRMITKHCPECEVQVAIASKKCSCGHVFSMRQSSAAVYEPPSRTKAGKRKAAQAASA
SSSDGRKGSGQVQRRRTSRVRREKPNYYDSLQYEKKKKKTKKSSKSSLFKGKDAKQTQLI
TAKDTQAARANRHANRRAKKEEIDGGGDLAAKLPLDKQEVAAIILSEINRKIGSVVWTQP
Download sequence
Identical sequences A0A182HKV1 A0A182L956 A0A182P2D6 A0A182UZC1 A0A182X9X1 Q380G4
7165.AGAP001428-PA XP_551404.1.40869 AGAP001428-PA AGAP001428-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]