SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182LXA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182LXA0
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily L27 domain 8.63e-20
Family L27 domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182LXA0
Sequence length 135
Comment (tr|A0A182LXA0|A0A182LXA0_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACUA004182-PA} KW=Complete proteome; Reference proteome OX=139723 OS=Anopheles culicifacies. GN= OC=Culicidae; Anophelinae; Anopheles; culicifacies species complex.
Sequence
MTDAHETSGKRLLQAHRALELLEDYHSRLSTPQDRALRSAIERVIRIFKSRLFQALLDIQ
EFYELTLLDESKTVQQKTAETLLIASKWEQDNAIKANEHQVHVEPPTFGHTGKGSASGQG
AIDTWHSICASRAGQ
Download sequence
Identical sequences A0A182LXA0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]