SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182M2X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182M2X1
Domain Number 1 Region: 182-272
Classification Level Classification E-value
Superfamily TIMP-like 8.32e-17
Family Netrin-like domain (NTR/C345C module) 0.038
Further Details:      
 
Domain Number 2 Region: 14-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 104-142
Classification Level Classification E-value
Superfamily TIMP-like 0.0000153
Family Tissue inhibitor of metalloproteinases, TIMP 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182M2X1
Sequence length 277
Comment (tr|A0A182M2X1|A0A182M2X1_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACUA008128-PA} KW=Complete proteome; Reference proteome OX=139723 OS=Anopheles culicifacies. GN= OC=Culicidae; Anophelinae; Anopheles; culicifacies species complex.
Sequence
MWTWSSVEFYGTACDCHPIGSSGKTCNHTTGQCPCKDGVTGLTCNRCARGYQQSRSHIAP
CIKIPRVINMVHSQNTAPEENHQYAVSSGNHEPEAPSYRMHAGRECGKCKITTKRLNLNK
FCKRDYAIMAKVIGKDTKPDNGITKGSTGSGNIGPNQHPYQQPYQPPSQRYRNSPPEDAV
VQFHLSVQKVFKRSRNPVSPLAKASKWSDVPYIVSAHDLDCRCPKLKVHRSYLILGNDSE
GPTGMLGVGPRSILIEWRDEWHRRLRKFQRQADRTCH
Download sequence
Identical sequences A0A182M2X1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]