SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182MVY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182MVY3
Domain Number 1 Region: 68-110
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182MVY3
Sequence length 137
Comment (tr|A0A182MVY3|A0A182MVY3_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ACUA027579-PA} KW=Complete proteome; Reference proteome OX=139723 OS=Anopheles culicifacies. GN= OC=Culicidae; Anophelinae; Anopheles; culicifacies species complex.
Sequence
MRHISSINLPRSAGGSTIVEAEYLTPATTNGVVQAKLAHFDRHVTRESSGNRVRKTKNKR
SMSSQQKHRIQVPDGLRDVLLEFSIAYLLEQPGDVIDYAVTFFTKLQEDRKTTMITSAEP
TSPDESIMSHDEAHNAL
Download sequence
Identical sequences A0A182MVY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]