SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182N9S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182N9S5
Domain Number 1 Region: 11-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182N9S5
Sequence length 652
Comment (tr|A0A182N9S5|A0A182N9S5_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ADIR004401-PA} KW=Complete proteome; Reference proteome OX=7168 OS=Anopheles dirus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVLLQEIYCPEQIVIPENFHLTLKQYAKAVIRTQPFDLLRWSAAYFRCLALSVKPPVKSR
YEPPAHHGSLTSGIVRVLIDQLGKGYYVQKKILLEKWEGLCLPEDVAGTTEMICEMLTED
PEGGAASVPLWMFRECFLAVADLDCGSVQKFVNGRKVLDEDTGALEEEQMPPALPKVLST
ISFKNAIIDKYRAMVEEEPEQQHQQQPYPTLSRNINIDNNDQLSDLSAVPSRLESDFKFF
GDDTDAHEIIRRAPDFDSVIVLLRRLRGDDVIPMVSCTNLSKPALERTRERSRQIEELKA
TISEEEYRQLKEQERQELLKEMGPPWLLLYLFSQDCSRTKSFNYVEQSSTSISDESVSAY
SMENLYDDTLELDPFAMVAQERRKSSFSLPVTLRARMSVSSHSAAVITNDILSKVVCTID
QAIVDGECELSVGSIANFLEQKTTSSEDFLAPADHEKLQSFLKEAESRELEVKDINELYN
FFVSESFKRALQDNGSESQPKEIFNIFGESGIEVDANLLEAKISDNMILGLVAPPPLEEP
SEKSEELAEVSSAPSAIIPTPSMHTLLASIHEGATQTDPIEIACRQRKIPLAPTEDQRIT
YKCKISPIPGIGSPLSEHVRDAFLTYLAQRAVEQQGLIYPRNFREALCPKID
Download sequence
Identical sequences A0A182N9S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]