SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182NMP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182NMP5
Domain Number 1 Region: 425-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-53
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 86-451
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.63e-51
Family Ankyrin repeat 0.0000748
Further Details:      
 
Domain Number 3 Region: 780-862
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 664-781
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.72e-19
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 7-124
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000759
Family Pseudo ankyrin repeat 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182NMP5
Sequence length 869
Comment (tr|A0A182NMP5|A0A182NMP5_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:ADIR008930-PA} KW=Complete proteome; Reference proteome OX=7168 OS=Anopheles dirus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGRSTAIAQTLLETGGADMNAYTTEGNTLLIDAIKRGDSFTAQFLLEKGCNVDLVTRDTS
DTALHLVCTYSERSTDAETHREMLSIGRQLLKQQADPNMQNSKGYTPLHVAIMSQHVEMI
DELLTETDGSYVDTNIRTKDEKCALQLALMPPHTDGAPFELARRLLERGARSNVINPETG
DSLLHSLAKQQLEDAAVFLTDHCNLSHINRSGLTVLHVAASQGLANLTRALLEKGAPPNV
QSGVTELKTALHYAVEENYAPVVEAVIDYKEANPPGTVDFNVKNAFGDSPLSLALSLGYN
ELVPLLIKGGADVNARNGQDMTLLHQAILKEDSKTAVFLLSQGADMNALTADQESPLQLA
IHCRLVDVVDALCSRGVSLSAPDNKGDCPLWSALESEQFEIASVLVRHGVDTDCWGPGPE
GCLQTLLHRAIDENKEQAAMFLIKSGCDLDSPRQPGPQGQGGDEAKDKASPLHLCCQWGL
RNVLHTLIGHGANVNAVDCDLKTPLHVAIENQHEEIIGILLCHPGIDLKIRDKTGNTPFA
AALQVRNNKAAQNILERLPNAAEQIDQRGRNFLHLAIMRDDLESVLFLLSIQVDVNSRVH
DVNQTPPLHLAAASDKEMLIRNLILAGARLNDRDATQKTALHVAAERGTVGAVSALLQNG
ADFDAVDGDGNNALHIAVREGHIAVVRELLTESELNAEAANLKGRNPLHELCRCGKDNTA
AAILELFFECMPKYPINNPDLQGNTPLLLAYMRGQAQLCRILVKNGACLGAENKEGLTIF
NFKLATNQLLHRLLDELPQESPWASSELCQECGTKFTLTMRKHHCRHCGRNLCSRCSNND
VPIIKFGINKPVRVCSVCFEVLQIGSGVV
Download sequence
Identical sequences A0A182NMP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]