SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182P2M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182P2M9
Domain Number 1 Region: 90-180
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.49e-32
Family Inhibitor of apoptosis (IAP) repeat 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182P2M9
Sequence length 248
Comment (tr|A0A182P2M9|A0A182P2M9_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AEPI001163-PA} KW=Complete proteome; Reference proteome OX=199890 OS=Anopheles epiroticus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSRSSADIEGGSAMNSNSGGGSFGTNCCSVKGVHFLLDGCGQFCLSTSKVGYNRVFGPNV
LLCDDLLAHVSIMASNSSSGQRGGIQQVEMPYMPDYASLDTRIRSFRNWNYGHVQDPTRL
AEAGLYYTGPEDEVRCFHCDGGLRDWLVTDDPWHEHARSFAGCNFLQLVLGETYISEVLR
NGNVGIADEGCTTSSATVSQTSSSSTTSIERGPPERFATIINPAAIQSTTLMPKCSFHIQ
CSPIVARW
Download sequence
Identical sequences A0A182P2M9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]