SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182PKS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182PKS1
Domain Number 1 Region: 29-143
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.83e-34
Family Insect pheromone/odorant-binding proteins 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182PKS1
Sequence length 144
Comment (tr|A0A182PKS1|A0A182PKS1_9DIPT) Odorant-binding protein 1 {ECO:0000313|VectorBase:AEPI007538-PA} KW=Complete proteome; Reference proteome OX=199890 OS=Anopheles epiroticus. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MKRLILLIVGLVCCSAILADTSPRRDAEYPPPELLEALKPLHDICVGKTGVTDEAIKKFS
DEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPDSMHDIAMHMGKRCLYPEGE
TLCDKAFWLHKCWKQSDPKHYFLV
Download sequence
Identical sequences A0A182PKS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]