SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182RDX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182RDX5
Domain Number 1 Region: 11-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182RDX5
Sequence length 678
Comment (tr|A0A182RDX5|A0A182RDX5_ANOFN) Uncharacterized protein {ECO:0000313|VectorBase:AFUN004397-PA} KW=Complete proteome; Reference proteome OX=62324 OS=Anopheles funestus (African malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVLLQEIYCPEQIVIPENFHITLKQYAKAVIRTQPFDLLRWSAAYFRCLALSVQPPVKSR
YEPPERRGMLSSGIVRVLIDQLGKGYYVHKRILLEKWEGLCLPEEDLLNVLSLLRMLNWS
QLHWLKIVAVFIGQLCKDFARTAEMICEMLTEDPEGGAASIPYWMFRECFLAVADLDCGS
AQKFVNGRKVLDEDTGALEEEQMPPTLPKVLSTISFKNAIIDKYRSTLEHEPEQQYSALS
HNINIGDNDQLSEPSAIPSRLESDFKFFGDDTDARAVLRRAPDFDSVIVLLRRLRGDGVT
SMVSESNLSKAALERTQERSKQIEELKVTISEEEYAKLKEQERQELLKEMGPPWLLLYLF
SQDCSRTKSFNYVEQSSTSISDDSVSAYSMENIYEDTLELDPSATFMQRRKSSFSLPVTL
RARMSVSSHSAAFITNEILSKVVCTIDQAILDGECELSVGSIANFLEQKSNSSEEFLSPT
DHEKLQSFLKEAESRELEVKDINELYNFFVSESFKHALQSNENEPHQKEIFSIFGESGIE
VDANLLEAKISDNMILGLVAPPPVQEPSEDANDQPDTAEPSAILLTPSMDTLGPTACEGT
TQTDPIEIACVQRKIPLVPTEDQRISYKCKISAIPGIGSPLGESVRDAFLAYLAQRSVEQ
QGLIYPRNFREARCPRID
Download sequence
Identical sequences A0A182RDX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]