SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182S495 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182S495
Domain Number 1 Region: 50-217
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182S495
Sequence length 256
Comment (tr|A0A182S495|A0A182S495_ANOFN) Uncharacterized protein {ECO:0000313|VectorBase:AFUN015213-PA} KW=Complete proteome; Reference proteome OX=62324 OS=Anopheles funestus (African malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MEEREYKKIFVKCVDRQDLADELSKHLVKYLNADKQIDIYSPLAELNHSSVIGEVIDANN
VSMFGQLSTIPHPMALDSDDNARRLFELLTLKRAPDGIQMYLLDKHPTLVSMIHGNQSLF
VYAKCAIKNNQTKLFKIIFKLICRKNNIPCVEEDNIIDAFADQNDVGLEIPFAYNCCNFY
YQRSKFNIESLLFEAIHKGNIQIVSYIIQKTNMDDMAEVFETTVHKIRGNDHENKNYKYS
ITFIQIFIQENRQEGS
Download sequence
Identical sequences A0A182S495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]