SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182SS76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182SS76
Domain Number 1 Region: 15-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182SS76
Sequence length 363
Comment (tr|A0A182SS76|A0A182SS76_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMAM012349-PA} KW=Complete proteome; Reference proteome OX=74869 OS=Anopheles maculatus. GN= OC=Culicidae; Anophelinae; Anopheles; Anopheles maculatus group.
Sequence
MNYLLHRQRSPGAVIPIPEELEELMSEISREVLRKQPPDVIHFLADYLEEKLARRENRRI
AEKIVDNVLDVSLDIVAMLESVGIDTVRAEEAVKRIREEFHRHFETKPDNEQLRDTFRER
DILERLVKECHFSEQEARKASRIIEHAYQTFYYRNAYKEPHPVGKDKDWRQAAKHTLGLY
AQTGPTREEMEVAARRIQVAYRAYYTRKRQEMDRNATIIQRAVRNYRSRRLEEAEISGVP
SIVLVHRIIDEDLYYTPSEDIHHLIDVAVGPEDDHNHVPSKDLTTDEAATLIQSVFRGHQ
ARKQTVPRVSTKSLSVNHPDVDEEKAAILLQSTARGHLARKRIQEDKEKHQMATMLQASI
VGQ
Download sequence
Identical sequences A0A182SS76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]