SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182UBB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182UBB3
Domain Number 1 Region: 39-86
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.06e-16
Family Cysteine-rich DNA binding domain, (DM domain) 0.0005
Further Details:      
 
Domain Number 2 Region: 175-214
Classification Level Classification E-value
Superfamily UBA-like 0.0000166
Family CUE domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182UBB3
Sequence length 295
Comment (tr|A0A182UBB3|A0A182UBB3_9DIPT) Uncharacterized protein {ECO:0000313|VectorBase:AMEC017309-PA} KW=Complete proteome; Reference proteome OX=34690 OS=Anopheles melas. GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSSASSGRITSSSSSSSSSSRPCGSSTGSSAMNGVGSNFRVPKCARCRNHGVISGLRGHK
KLCSYRNCRCAKCELILSRQKIMAAQVALKRQQAVEDAIALRLASTETGTQLEALPPGKI
YGMTVTEPCPSPSPSSSTASVDVISSTSSDGLGGFETPEDVRLSRPKATGNVTVSQNALD
MLAKLFPHRKRSVLELILKRCDSDLLKAIEQCSQTQNISAFKPPTPTAPPTTVAAPSTST
TMNQPPISPNSYSPFIAYPKWLLPMSIPVSFSHIAPNLAPRCTLPNCVMCVHHPM
Download sequence
Identical sequences A0A182UBB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]