SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183ANX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183ANX1
Domain Number 1 Region: 97-215
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-26
Family cAMP-binding domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 223-285
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000011
Family cAMP-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000212
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183ANX1
Sequence length 298
Comment (tr|A0A183ANX1|A0A183ANX1_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:ECPE_0000868201-mRNA-1} KW=Complete proteome; Reference proteome OX=27848 OS=Echinostoma caproni. GN= OC=Echinostoma.
Sequence
MAEKIKVPTGLRELLQEFTVSVLREQPKDLVQAAIEFFTMKKNAADNRPRKQGDSDEDED
DEPMPPPPRNVGRRAGVAAESYDPEKDDESSNIKVVHPKTEAQRQRLTQATKDILLFRCL
DDDQMKDVIDAMFERRVSPGDKVITLGEDGDNFYVIESGVYDIIVKIQGEEKTVGKYDNK
GSFGELALMYNTPRAATILAVLWAMTREVFRSIVLKKAFEKRRMYEELLNQVPILESLSA
YERMSIADALKTRIYEDGAQILKQGDPGDEMFFVEDGEVCIKMKRVGETEEKEVTRIE
Download sequence
Identical sequences A0A183ANX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]