SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183D457 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183D457
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 3.92e-21
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183D457
Sequence length 114
Comment (tr|A0A183D457|A0A183D457_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:GPUH_0000350401-mRNA-1} KW=Complete proteome; Reference proteome OX=637853 OS=Gongylonema pulchrum. GN= OC=Spiruromorpha; Spiruroidea; Gongylonematidae; Gongylonema.
Sequence
LQKLSTAIGGDLQIVGDKILTLFNEQRNFIWAAAGQKEPPANELQAKLGPIVKLMEEIST
FKESKRNTPLFNHISAASEGIQALGWLTVVSVFFFFVFYITVSLTFCVLFYALN
Download sequence
Identical sequences A0A183D457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]