SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183E1F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183E1F0
Domain Number 1 Region: 134-257
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-30
Family cAMP-binding domain 0.00000894
Further Details:      
 
Domain Number 2 Region: 258-380
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-30
Family cAMP-binding domain 0.0000104
Further Details:      
 
Domain Number 3 Region: 14-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 4.84e-17
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183E1F0
Sequence length 396
Comment (tr|A0A183E1F0|A0A183E1F0_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:GPUH_0001481001-mRNA-1} KW=Complete proteome; Reference proteome OX=637853 OS=Gongylonema pulchrum. GN= OC=Spiruromorpha; Spiruroidea; Gongylonematidae; Gongylonema.
Sequence
LDMASGGGSEEAQLAQCQAYVQRHNIQQLVKEAIVSLCINKPENPILFLKEHFEKLYEQR
SQVPGCSPACYLCFSSCVHRLLQVSSPRAEAADDDDTIDEPPKLPQGNRRRLGVSAEVPD
EKEAANYDKVVIPKDEETRRALEAAMCKNILFSHLEGDEQKAIFDAMFPVEKKKGETIIE
QGEEGDNFYVIDSGEVDVFVNGEYAVSIKEGGSFGELALIYGTPRAATVIAKSDVVKCWA
IDRITYRQILMGSTMRKRKLYDEFLSKVQILSDLDKWERANVADALERCDFEPGTHVVEQ
GQPGDEFFIIVEGQADVLQKRSDDAPFEIVGHLTSSDYFGEIALLLDRPRAATVVAKTPL
KCVKLDRARFERVMGPVREILKRDVSNYNSYVKLMT
Download sequence
Identical sequences A0A183E1F0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]