SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183K6E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183K6E2
Domain Number 1 Region: 87-114
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000012
Family Somatomedin B domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183K6E2
Sequence length 119
Comment (tr|A0A183K6E2|A0A183K6E2_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SCUD_0001056701-mRNA-1} KW=Complete proteome; Reference proteome OX=6186 OS=Schistosoma curassoni. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MIRSVQNRLNIQFNSKLFHWVILFLFYITINQISLVISNGCLQPNGMSICCAGREKKCFV
YKSTGQSSISRYYPWKKYRSVAGHSSPRDRCYCDESCVITGDCCHDYHFTCQKTSKSIC
Download sequence
Identical sequences A0A183K6E2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]