SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183MV12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183MV12
Domain Number 1 Region: 199-232
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000000968
Family CCHHC domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183MV12
Sequence length 241
Comment (tr|A0A183MV12|A0A183MV12_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SMRZ_0001988801-mRNA-1} KW=Complete proteome; Reference proteome OX=48269 OS=Schistosoma margrebowiei. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MNINNQLDNSLNEPTINLEQISPIPKNSFPVDGRNEGNSIKICNDYYDNKKFITSSEFIH
NNNYYPMHNPNNKINNNNNNILDNTTHDNLVVKQSLLSKQNENTKKTNHFVNYLLENNEF
NQTNINMNQDKNDNKNLILFDMMNTSLNSPSSSISSKSDLDNHNNQNSNDYLSKKKLQQN
VSFKIQSIQGAKKDRNTEGRCPIRDCDGTGHATGLYSYHRSVSGCPRKDRASVAGKQLTL
V
Download sequence
Identical sequences A0A183MV12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]