SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183P916 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183P916
Domain Number 1 Region: 18-121
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.00000759
Family ETX/MTX2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183P916
Sequence length 124
Comment (tr|A0A183P916|A0A183P916_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SMTD_0001085101-mRNA-1} KW=Complete proteome; Reference proteome OX=31246 OS=Schistosoma mattheei. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MNRSITPKQIKEPELFDITNQLKLWAINMYHLTATKDQKKYDPIELILRILWDDIHVNNE
KPEYYDNNRIKLPKSNILFSTTFKNNTDSEQEYNFHTERCTRSIIEIEIQKGVILSKELS
LKLA
Download sequence
Identical sequences A0A183P916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]