SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183PT12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183PT12
Domain Number 1 Region: 5-88,131-173
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000000000405
Family IP3 receptor type 1 binding core, domain 2 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183PT12
Sequence length 176
Comment (tr|A0A183PT12|A0A183PT12_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SMTD_0001749701-mRNA-1} KW=Complete proteome; Reference proteome OX=31246 OS=Schistosoma mattheei. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
LDFASDSFKALRAILCILNEHGKLTETRMRSLIFILSELVMFLNGNTRLTFESTNPTIQN
EIGLRDRQKLLREHNIIAQIFDILNSKVISNLPKQSTSIVNNHLINSNILIWKPDISLIS
ILHETEINTIDSQQQDIYLDEKNEILAWQTVGNLCYRILTLSQHGYRKNQVTLKMI
Download sequence
Identical sequences A0A183PT12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]