SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183Q423 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183Q423
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000144
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183Q423
Sequence length 169
Comment (tr|A0A183Q423|A0A183Q423_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SMTD_0002135801-mRNA-1} KW=Complete proteome; Reference proteome OX=31246 OS=Schistosoma mattheei. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MNISTTTTTTLGNNNTNNDNNNNCNRLLKHQTTIDLNNIELPIIEGELTDIERLYLYAAE
QGDLGTIKQLTDQANELKLNLNCTDTLGRDVLRIAIENEHMELLQFLVALPKLDLKDCIL
HAINEDNVIAVEIILHAQAERGGKKNLRVSSCLFFLFFLLLLKCIVLLL
Download sequence
Identical sequences A0A183Q423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]