SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183QA82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A183QA82
Domain Number - Region: 40-79
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A183QA82
Sequence length 90
Comment (tr|A0A183QA82|A0A183QA82_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SROB_0000052201-mRNA-1} KW=Complete proteome; Reference proteome OX=6188 OS=Schistosoma rodhaini. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MPNEQIHIEHFIQSLSSTISYVKSDIRLEATSAELQSLPIRTYLERLVVPVLIHGLTQLC
KERPQKPIEYLAAYLLKNKNYKQNINTGTK
Download sequence
Identical sequences A0A183QA82 G4VT64
Smp_026440 XP_018655577.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]