SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183QDG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183QDG4
Domain Number 1 Region: 86-195,238-263
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000128
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183QDG4
Sequence length 1172
Comment (tr|A0A183QDG4|A0A183QDG4_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SROB_0000166801-mRNA-1} KW=Complete proteome; Reference proteome OX=6188 OS=Schistosoma rodhaini. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MDPFIIDSYKLKRSLSTNNLEQFHRHSVFTEKRKYSKNSRSLHKHPFNTSLIQLRKNKNT
NGCELRPIHDILNEIENNSMNNTTYNTTINHNTTDNDNNNNHLFKPDTNVDLNNIELPII
ENELSNIERLFLYAAEQGDLGTIKQLTDQVNELKLNLNCTDTLGRDVLRIAIENEHMELL
QFLVALPQLDLKDCILHAINEDNVIAVEIILHAQTERGSKKNLKGLLGRFQSSSFTPDIN
GIILAAHRDNYVILKLLLDRGDRIYKPHDLRCACNICTKARRENGLQHSTLRINTYRALT
SPSFIILTSNDPILTAHWNRPAVSSVLCNTSTEYEELEAKCQKFATDMLAQTRSSSELSI
VLNHYTGADVSGCHVSGINQSLSEDIIEKMQLSRLKLAIRYGQKQFVAHPHCQQLLAAIW
YEGLPGFRQKPVFAQLTTIGTLCSLFPLLATFYMLAPHSKLGSMMRKPFIKFLCHSSSYL
SFLALLTLAATRVEFLLTNSLDQRMHDRGPTPSLTESALVIYVIGFVWQQMKKLYIWGLR
AYLTDMWNLVDFVMNALYIATISLRTVAWARIVFYNEPRYINRGQWDSFDPVLVSECLFA
AANIVSTLKLVYVFTVSPQLGPLQISLGRMLHDIFKFFCVYFLVLVAFAFGFNQLYWFYA
KNRSRNCKNVHFTLEEGQKDVYDYCITRGTYFTNLFEIVQSLYWSAYGLIDLTSLNLEYP
HAFTEFVGKLTFGTYSYIAFIVLLNMLIAMMNNSYEQIVGQVDIEWKFARSKLWISYFGE
GCTVPVPFNIIPTPKTFMYMLNTIKNLFLNCSNKKQLHRNDWETIRLRIKQVKECETRYQ
NVMHELTKRYLMQKLRSSENDIVTADDLSEIKGDISAFRHELLDILKSNGMKIPAYHKTA
LVSKLRRGREVYQLSEIQEMVRGKKSKESIKRANISINENKSTQSKPLFSDIKQPVHRKI
TTSTGINKSDFDKTLLPSSTSIGGIIGPVDNPAFENEEVIVNKTSINSSIDLDEKKQRKS
TTVLDQETSVSDVTSQQLNPNFIPCTSTVVCEETITNNTDQNTVEKQFQQSKLKQPPSQL
SIETKTPSMNIIKNDKMPNLKNLTFTNETRSQTVKQDHADKIESVENEATSQLFSDRKSA
DHKTIEHCKLNKISHHPMDDCSQIKNQRSDLV
Download sequence
Identical sequences A0A183QDG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]