SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183RWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183RWR9
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.000000012
Family ETX/MTX2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183RWR9
Sequence length 105
Comment (tr|A0A183RWR9|A0A183RWR9_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SROB_0002049201-mRNA-1} KW=Complete proteome; Reference proteome OX=6188 OS=Schistosoma rodhaini. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MNDYVIVVPPGYNTRAELIITEDEYYGKFQVETIFEGSISVKLRDKKDGSVVSVVIINDL
SKLLTAKNGFHPIPNSTNAVCFVNEGSCHCHYGVGQRVELQEEKI
Download sequence
Identical sequences A0A183RWR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]