SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A183UFE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183UFE1
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 6.8e-22
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A183UFE1
Sequence length 72
Comment (tr|A0A183UFE1|A0A183UFE1_TOXCA) Uncharacterized protein {ECO:0000313|WBParaSite:TCNE_0000721101-mRNA-1} KW=Complete proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN= OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MLSSTFQDLVKTHLMFAVREEVEILRAKIIELETTVLQLEAENAVLREHVPAEILSKLSL
QATQGSAATAAV
Download sequence
Identical sequences A0A183UFE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]