SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A191VZ36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A191VZ36
Domain Number 1 Region: 1832-2176
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.03e-74
Family Duffy binding domain 0.000058
Further Details:      
 
Domain Number 2 Region: 1029-1378
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-73
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 3 Region: 589-935
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.24e-66
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 2303-2656
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-63
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1402-1740
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-55
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 6 Region: 2688-2955
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-50
Family Duffy binding domain 0.0003
Further Details:      
 
Domain Number 7 Region: 1-274
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-45
Family Duffy binding domain 0.00076
Further Details:      
 
Domain Number 8 Region: 307-515
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-31
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A191VZ36
Sequence length 3067
Comment (tr|A0A191VZ36|A0A191VZ36_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ANJ20978.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAELSKLSLEKVREYWWAIHRKELWE
ALTCSAPKGANYFVYKLDRPKFSSDRCGHNYNGDPLTNLDYVPQYLRWFDEWGEEFCRKR
KIKLENVEKACRKDSEKLYCRHNGYDCTKTIKNENILFDDPKCTDCLIKCSLYEIWLDNQ
QKEFEKQKEKYEKEIQTYISNNEISNNNISNEYNKQISEKYTDKKYETLDKFLNLLKEGK
YCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCEVDCENGNCEVKNKPDGNCGKNVKYK
PPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNINVKNNETWKCYYKNSDNNKCKMES
NSENNKGAEKITSFHEFFELWVKNLLKDTMKWENEIKDCINNTNITDCNDECNKNCVCFD
KWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFESFLFKVISELDQGEAKWNQLKEEL
KKKIESSKANEGIKDSESAIELLLDHLKESATTCKDNNANEACSSSQKSSPNPCADKSGG
KLVSVKQIAQYIKRQAYEQANYRSDGLHKLKGKAHEGKYKRKGRENYFKDKLCKIGKYHS
NRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIYNDVYLPPRREHMCTSNLEHLVTD
NKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDYEPVSDEQSICRAVRYSFADLADI
IRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGKYTNTDGKYLELREDWWEANRAKV
WEAMKCAIKGLNVTSSDGKLSDHCGYSDHTPLDDYIPQKLRWMAEWAEWYCKVQSQEYDK
LKKSCVMCMQKDNGKNCWKHNSECGVCKGACTAYQGKLLPWEYQWNVISHKYETLYEKAR
IAADNGGLDTSSGDIDPKDKTLVEFLFNLYVQNGGKIGTIGTTGDKDTRDTTPTVYSTAA
GYIHEEAHIGDCKEQKKFCEKKNGAKPPSGDLEVDNEYAFRDKPTDHDKVCDCESGEKLQ
YKKKEGIVLEEPCNVVKTLLKDKNENSDIGQCIRKYKDGNEKYPVWDCTRNKIKIGEGAY
MPPRRQKLCVDFLKQLKDQTDEKLRDAFIKSAAAETFLSWHKYKEDTQKEKATHTADNDL
NKGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNVESKIEGVFSKADGTSSSNLSREVW
WKKHGPKIWEGMLCALPGTENFKNKADYKNPPEDFAKQPQFLRWLTEWYDDYCHTRQKYL
TRVESTCKLNDQSQCAAECNNKCDEYKKYMEGKKKEWDAQYKYYKEQRNKKEVVNDSKGI
IVKDYVLANAKEYLKKKFTAICVTSSGKAQNSATEEVKKNIELLSEEQYYDANEHCGCTK
FIHDGKYSKISGRSNCYGLNSDAKKNKIKWRNGDEKDYAFLKKRNLSGEVFFPSRRLGIC
FRGLDGYYRYPEVKDKDTLRKTLMEVAATEGYNLGQYYKEKKKANKEAYRYSYEVRPYSA
MKYSFYDLRDIILGYDNLEDNSTTTEKNMKEIFKSESNEGSQGRQTFWNNNKDCVWEAMK
CGYNKSGETIPDECKNMPRDSDYPIASNRDEGTAYQFLRWFAEWGEDFCKHKEKELKKLV
GACNDYNCGDNEDKKKKCTSACTQYKQFISEWKPQYENQIKKYGKHKHKIYSEHPVAKDA
KDAREYLDKQLQKFCENKSGDCEYNCMKDASTQLLTDGHSQNMPASLEDEPKEVEGKCNC
PVPPGRPRARRETPSPRVPLTAKATTSKKEAKTEPSTKPPKKVEKPRTEIQSPARKRTRR
AAQQTRTRTVREAPQAPTQTARAAPQELTRTSTPTTTPSDVATMIKDIFSKKRDRKGGIE
NCYPKTNGQYPQWDCNPRKFKENENGPCMPPRRKKLCINNLQYLNNKTETKNENDIKEAF
IKCTAIETHFLWKRYKGNNDEVDEKLKYGDIPKDFIRIMFYTFGDYRDIFFGTDICKDKN
IDTISQNVEKLLKKKKDNISKNIDEVKRYYWEQYGPDIWKGMLYGLTYHLKDEGKNRIPE
DSKYQYNKLKPDLEEFAKRPQFLRWFTEWAEEFCNKRKEQLKKLEAGCKEYECNGSDDGK
TQECAEACVTYQKFIKKWKTEYERQREKFKKDKDGKKYKDYPSTERDIEKATCAHEYLNM
KLKELCGNKDCSCMQKPSSQLPKTTQQSQSSDANDMPESLDYVPEEFNKCECPELSKKGS
MIHTKKITEPKIPMNCVEKAAYYLSKEAENNMDITLKEKFIPIESTKEKESKNSWTNNNP
CDPKKPYSPHKYVSINPCEGKGKDRFKVHSELKCYKNLKGYTETKTVCVPPRREHMCLRN
LNEIKIERLKDSNYLLKMVRRTARNEGIDIIKNFNSENGCAMNPICDTMKYSFADLGDIV
RGTDMLRIGGYLPPVEIKLYKVFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWK
AMTCKAPEDAKLFRKGRMDGFERITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKA
LIDELEKFKKSCDHCKTTDRCKNDYDKNKCEECKTRCQEYKNFVLKWKSLFDIQSNKYKE
LYEQPIDTKISAYDHVQNFVQKLKSFKSECSVESFSEYLHETSKCLNYKFNENDGSNIRS
YAFEETPKSYKEACSCTLHSKNPLDNCPTDQNKDGCKELQTCTFCSKNDYDNNLDNWNAY
LVRNSSDDNKGVLIPPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKS
EKELCFEAMKYSYADYSDIIKGTDMMDTSLSEKIKKIFETSNQDTEDCKTWWEKNRSHVW
HAMLCGYKIATSNVTLDEGWCELPKDEETNQFLRWLIEWAKQACKEKKHITNSLKTKCRC
SNKDNFKASELLRQPGCQNDIRKYISLNILIQNSMENLNIKYKKFKDQSSGNIDNKPSEE
NVQSYIKSKDSQCALELNDINEIVTGTKNNENNEFKEVLKKLYPGLYFVEDETHKNHVLD
GNIKEEEQTVRPEVLYFFTPHVDYLYQGLFLPTYRGEKYDPKNDILKSSISVVIVSALGL
IALLFMK
Download sequence
Identical sequences A0A191VZ36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]