SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A193D237 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A193D237
Domain Number 1 Region: 22-211
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.000000000000772
Family Hypothetical protein YwqG 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A193D237
Sequence length 232
Comment (tr|A0A193D237|A0A193D237_BACTU) Uncharacterized protein {ECO:0000313|EMBL:ANN35708.1} KW=Complete proteome OX=180843 OS=Bacillus thuringiensis serovar coreanensis. GN=A9498_30500 OC=Bacillus cereus group.
Sequence
MEIVQIKNILRKKATLFQTGGKRPDLSINESWIGKIPYSLPNETYPIDRYQERMYAIMML
NLTQIPFVPEAVKSTKAIAVFLSPNFAKDLSNLSGNFCIREYDSIEELVPNEMSLTFPAL
KPFPLIPKLVVNEFPQWDTEDFPNNIQDKILELENTIEIDYYEDIFEENHYIHKLGGYAC
FAQSGIQWPADYEFIFQITDDPKAHLKIIHGGGIYFAKNSKTNDWIAHCDFL
Download sequence
Identical sequences A0A193D237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]