SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A193F990 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A193F990
Domain Number - Region: 28-83
Classification Level Classification E-value
Superfamily Stathmin 0.0301
Family Stathmin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A193F990
Sequence length 88
Comment (tr|A0A193F990|A0A193F990_BRAHO) Uncharacterized protein {ECO:0000313|EMBL:ANN63863.1} KW=Complete proteome OX=1266923 OS=Brachyspira hyodysenteriae ATCC 27164. GN=BHYOB78_08280 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MSREVSGMFSFLLGLSAGLALGVLFAPKAGEETREDIKETMDNIKYKVDDIYHRSVLKTS
ELVEKGKEKTNDFFEKRKKKSSEETVEE
Download sequence
Identical sequences A0A193F990 C0R1P2
565034.BHWA1_01560 gi|225620477|ref|YP_002721734.1| WP_012671072.1.100804 WP_012671072.1.11734 WP_012671072.1.24165 WP_012671072.1.24451 WP_012671072.1.28499 WP_012671072.1.37874 WP_012671072.1.38209 WP_012671072.1.44798 WP_012671072.1.45318 WP_012671072.1.54887 WP_012671072.1.54899 WP_012671072.1.64247 WP_012671072.1.64884 WP_012671072.1.67878 WP_012671072.1.68144 WP_012671072.1.68422 WP_012671072.1.68614 WP_012671072.1.75576 WP_012671072.1.75702 WP_012671072.1.85211 WP_012671072.1.88305 WP_012671072.1.89179 WP_012671072.1.95116 WP_012671072.1.95541 WP_012671072.1.9677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]