SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194PI39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194PI39
Domain Number 1 Region: 151-332
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.36e-47
Family DNA polymerase beta-like 0.00000303
Further Details:      
 
Domain Number 2 Region: 10-88
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 5.23e-21
Family DNA polymerase beta, N-terminal domain-like 0.0000728
Further Details:      
 
Domain Number 3 Region: 93-149
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000000000000719
Family DNA polymerase beta-like, second domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A194PI39
Sequence length 333
Comment (tr|A0A194PI39|A0A194PI39_PAPXU) DNA polymerase beta {ECO:0000313|EMBL:KPI92718.1} KW=Complete proteome; Reference proteome OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=RR46_13939 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MSKRKNPCESTNPNAEFCDFLMELAEYEKNVSRNIHKYNAYKKAASVLAAQPKKIESGKE
AKKLVGIGDKISKKIDEFIQTGKLRKIETIHNDEKAQAISMLTRVSGVGPVKAAELVKDG
IITIKDLKNSKQLLNHHQLIGLKYFEDFEKKIPRSEIQAIENKLKALVIGFDSNFTITIC
GSFRRGKAESGDIDVLATHLSLKPEGAKKKHGETMLKRLVDNLEGLIIDVISMGDTKFMG
VCRLSDDLPARRLDIRLIPCEQYHCAVLYFTGSDVFNKTMRTHALEKGFTLNEYYLRPMG
STGVPGEPVPIASEEDIFDYIEYPYKKPEERNL
Download sequence
Identical sequences A0A194PI39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]