SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194PVM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194PVM2
Domain Number 1 Region: 111-232
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-33
Family cAMP-binding domain 0.00000263
Further Details:      
 
Domain Number 2 Region: 233-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-28
Family cAMP-binding domain 0.00000909
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 5.75e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A194PVM2
Sequence length 380
Comment (tr|A0A194PVM2|A0A194PVM2_PAPXU) cAMP-dependent protein kinase type I regulatory subunit {ECO:0000313|EMBL:KPI97372.1} KW=Complete proteome; Reference proteome OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=RR46_09279 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MESMEEQQCLHQCESYIQTHNIQLLLKDCIVQLCLNKPENPVTFLRQYFQKLEREQVKAA
AAAAATSEGEGDGELSPLPLPAGQPPRRRGGISAEPVTEEDATSYVKKVVPKDYKTMGAL
SRAIASNVLFTHLDESERADMFDAMFPVQCLQGETVIRQGDEGDNFYIIDSGEVEVLVNG
ELVTTIGEGGSFGELALIYGTPRAATVRARSRLKLWGLDRDSYRRILMGSTIRKRRMYDE
FLSRVSILESLEKWERLTVADALEPVSFNDEETIVRQGEPGNDFYIIVEGTAVVLQQRGL
GEGGGEGAGEAVEVGRLGPSDYFGEIALLLDRPRAATVRAAGSLKCVKLDRARFERVLGL
CADILKRNIAQYNSFVSLSV
Download sequence
Identical sequences A0A194PVM2
XP_013171944.1.34343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]