SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194QF17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194QF17
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.63e-101
Family Capz alpha-1 subunit 0.0000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A194QF17
Sequence length 288
Comment (tr|A0A194QF17|A0A194QF17_PAPXU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KPJ04138.1} KW=Complete proteome; Reference proteome OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=RR46_07897 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MAADGDEVISDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDSLLKEGASGAFAQYNK
DQLTPVRLEGSELHTLITEHNELGGGRFFDPRSKRSFKYDHLRKEASEYEPYEPDRVAEP
WRAALDEELTAYVAAHYKHGASLVVGRAIDASTVSLVACIEDHQFQPKNYWNGRWRSVWS
LTVGAGAAELRGMLRVQVHYYEDGNVQLVSSKEVRAPLVATGEAATAKEFVRLVCEAENA
YQTAISDNYKTMSDTTFKALRRQLPVTRSKIDWARLVSYTIGKELKSQ
Download sequence
Identical sequences A0A194QF17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]