SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194S352 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194S352
Domain Number 1 Region: 267-414
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-31
Family cAMP-binding domain 0.0000332
Further Details:      
 
Domain Number 2 Region: 408-540
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-24
Family cAMP-binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A194S352
Sequence length 596
Comment (tr|A0A194S352|A0A194S352_RHOGW) Uncharacterized protein {ECO:0000313|EMBL:KPV75017.1} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_53924 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MSLPSSYSAILSDLNREVLRAQPSDPLQFCANWFAQRLEQERSATRAQASASSSTTNPGR
SSMARSSVDDSSMREATPPMSAKSMTGETPGARSLSPSGGKPAPTKGAGARPSSLAHQGY
AFGAAPGGPRDDAPSPFSEYPPGGGPARAGSSADAPAPGASRFSQSGASRVGAPTQGRAV
APTSDSEEEVDDPRDDPSYRPGVTGGAPFGGFGGVGGGGPGGQAQQGPGAGGLTVPSVNY
NLGRRTSVSAESLDPDAATQALPKTIIPKTPSQRQRIEKAISNNLLFRNLDVDQHTDVLN
AMKEVTVQAGTEVIVQGAVGDFFYVVEEGTFEVWVRGPPTHSYAGPGQSMVSQPGEEKKV
ATYGPGGSFGELALMYNAPRAATVVATSRATMWALDRVTFRSILVEHTSRKRKMYEAFLG
EVSILQELNAKERAKIADALEEKVYDEGEQVVVEGEVGKNFYIIESGRAEVTKRKRNAQG
GIDEEVLGVLGKGDYFGELALINSAPRAATVRARPGEGRLRVATLGEKAFTRLLGPIIDI
LARKAERSYGPGAAVSARGSTSGPLVGGGAGGDAQEGGVGGPGAPGSRGIAVGGEA
Download sequence
Identical sequences A0A194S352
jgi|Rhoba1_1|53924|estExt_Genemark1.C_70418 XP_018271066.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]