SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194S873 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194S873
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily GINS helical bundle-like 6.28e-20
Family PSF2 C-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A194S873
Sequence length 141
Comment (tr|A0A194S873|A0A194S873_RHOGW) Uncharacterized protein {ECO:0000313|EMBL:KPV76764.1} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_12594 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
FSDLPRDYLEVSKVLLEVASDDVPAPDRVRLLLKDIREARQAKVREGLAAINAVHLGMPN
LSTLELSELRPFFSLAFTRLRDLDPQAEAHREAEEWWMRDPAGCMDAARRGEVGGKRDGA
SFGAGGRGGRGDREGTEMSGL
Download sequence
Identical sequences A0A194S873
XP_018272813.1.32311 jgi|Rhoba1_1|12594|e_gw1.3.713.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]