SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194SD58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194SD58
Domain Number 1 Region: 3-342
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 1.31e-133
Family Clathrin heavy-chain terminal domain 0.00000000222
Further Details:      
 
Domain Number 2 Region: 1196-1529
Classification Level Classification E-value
Superfamily ARM repeat 1.38e-106
Family Clathrin heavy chain proximal leg segment 0.0000000024
Further Details:      
 
Domain Number 3 Region: 456-792
Classification Level Classification E-value
Superfamily ARM repeat 2.88e-98
Family Clathrin heavy-chain linker domain 0.00058
Further Details:      
 
Domain Number 4 Region: 344-499
Classification Level Classification E-value
Superfamily ARM repeat 9.78e-59
Family Clathrin heavy-chain linker domain 0.00000145
Further Details:      
 
Domain Number 5 Region: 903-1059
Classification Level Classification E-value
Superfamily ARM repeat 3.8e-31
Family Clathrin heavy chain proximal leg segment 0.069
Further Details:      
 
Domain Number 6 Region: 1049-1196
Classification Level Classification E-value
Superfamily ARM repeat 1.09e-24
Family Clathrin heavy chain proximal leg segment 0.019
Further Details:      
 
Domain Number 7 Region: 837-937
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000288
Family Clathrin heavy-chain linker domain 0.084
Further Details:      
 
Weak hits

Sequence:  A0A194SD58
Domain Number - Region: 1502-1586
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00772
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A194SD58
Sequence length 1663
Comment (tr|A0A194SD58|A0A194SD58_RHOGW) Clathrin heavy chain {ECO:0000256|PIRNR:PIRNR002290} KW=Complete proteome; Reference proteome OX=578459 OS=Rhodotorula graminis (strain WP1). GN=RHOBADRAFT_65971 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MVDRPIAFQELLQLTALGIQPGSIGFATLTLESDRFVCVREEVNGAKQVVIIDMADPNNV
VRRPISAESAIMHVDDKVIALRAQRQLQIFNIELKQKVSAHLMHEDVTFWKWISPTTIGI
VTETAVYHWTCYAPSSAPDSPTQDAPVKVFDRHASLAGNQIINYRVTPDEKWLVLVGISS
NTTNPAGFKVKGAMQLYSKERGVSQPIEGHAASFAELRLEGASDDTKLFAFAVRTATGAK
LHVVEIDHQANLPVYAKKAVDVFFPPEATNDFPVAMQVSKRFGIAYLVTKYGFIHLYDLE
SGACIYMNRISGETMFTTCEHRSTSGVIGINRKGQVLSVTVDEDVMIPYVLSTLNNVELA
IRLASRGNLPGADDLYSNQFQQLFQSGDYGAAAKVAASSPRGILRTSQTIELFKNVAAQP
GQLSPILQYFGILLERGKLNKFESLELARPVLVQGRKNLLEKWLKEDKIECSEELGDIVR
AHDMTLALSVYLRANVPNKVVACFAETGQFAKIIVYAKRVGYTPDYAALLQHVTRLNPEH
GAEFASQLVNDEMGPLVDIERVVDVFMSQNMIQQATSFLLDALKENRPEQAHLQTRLLEM
NLMNAPQVADAILGNNMFSHYDRPRIASLCEKAGLAQRALEHYDDIADIKRVVVHSNQLQ
PEFLVDFFGKLTVEQTLECFNEMLKVNIRQNLQVVVQAATKYSDLVGPVRLIEMFEKFKT
AEGLYYYLGSIVNLSEDSEVHFKYIQAATRTGQIREVERIVRESNYYNPEKVKNFLKEAK
LQDQLPLIIVCDRFDFVHDLVLYLYQNGLTNFIEVYVQRVNSARTPQVVGGLLDVDCDEA
TIKALLASVTGPVPVDELVDEVEKRNRLKLILPWIEAKVQAGQQDPALYNALAKIKIDSN
VDPEAFLKDNNAYDPLVVGRYCEKRDPYLAYIAYAKGLCDDELIAITTENAMYKHLARYL
VKRRRLELWQQVLGADNVHKRPLVDQVVATAVPESTDPEDVSVTVKAFLSADLPSELIEL
LEKIVLEQSAFSDNANLKKLLMLTAIRADKGRVMGYIDRVEGFDVQEIAGIMIEHGLHEE
AFTLFRKNNMHLEAMNTLVEYVVSIDRAQQYADKVDQPAVWSRLGKAQLDGLRVKDAIDS
YVRAEDPSNYLEVIETASRAGKHDDLVRYLQMARKTLREPAIDTELAVAYAKTDRLRDME
DFLSMTNVADLLSAGEKAFDAELYDAAKLLFSSISNWARLATTLIYLGENQAAVDAARKA
GNTQVWRQVNAACIDKKEFRLAQICGLNLVVHAEELSALVRLYEYQGYTDELMALLEAGL
GLERAHMGMFTELSVLYAQYKPERLMEHLKLFWSRINIPKVLRAAEQAHLWSELVFLYVK
YDEHDNAALAMMERSAAAWEHNQFKEVIVKVANIEIYYKALNFYLEQQPLLLNDLLTALA
PRIDHTRVVRLFQKADELPQIKNYLLAVQDRNLPAVNEAYNELLIEEEDHHSLRDSVDAN
DAFDSAALAYRLERHELLEFRRLAAHLYAKNSKWDRSIQLSKEDKLYKDAIATAATSGSV
DVAEELLRYFADIGSREGWLALAYAAFDSIRSDVMEETSWRHGFSDVFMPYKLTAARLAA
DRVVALERRLEALSTKASEDEQEEQQAGSFLMGSSSRAIAWTA
Download sequence
Identical sequences A0A194SD58
jgi|Rhoba1_1|65971|estExt_fgenesh1_kg.C_20017 XP_018273380.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]