SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194VZQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194VZQ7
Domain Number 1 Region: 40-210
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.62e-30
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00031
Further Details:      
 
Domain Number 2 Region: 404-513
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000719
Family Pseudo ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A194VZQ7
Sequence length 607
Comment (tr|A0A194VZQ7|A0A194VZQ7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KUI69270.1} KW=Complete proteome; Reference proteome OX=105487 OS=Valsa mali. GN=VM1G_05029 OC=Sordariomycetes; Sordariomycetidae; Diaporthales; Valsaceae; Valsa.
Sequence
MASSSTAEASPLADEPPPPRPIAIPSSIGRFPSTLSLSEMQRPRKLKLLVAANGSRDVAW
AQTIAVRLSKDSKIEVRAIVDDMTHRLAQEIICYQNRSCTQGDGNSKANDLHRRAFELVE
WADLLVLAPIDANNLAKMMNGIADTLLLELLRSWDASKRIVLVPGMSTHMWESPITKKQL
SKLHKKWQWIRVLQPILWSYESAEDHEIPKRVVRWGAFNELVGIIKNQSELLCLGHDVDA
STQGLVVKNGKRTSAKLPSELWSIIFEYTNDWELAQACGIYTNIPTPTYLGWRLEPRNPS
DPLSVYQHELEWTILSADTGAICQKLSEAPATFRELSALAIKLIFKFTLTRVLSYIEANC
PHMFKCFDGKTIPTKASAYYGRIEILDWWVRSPSFLQKQYDNEAVDVASKNGYVHVLEWW
RRSGLSLKYTAAAFEQASARGHIHVLEWWREAYLQNPDEIDLNPGKSILVAAQYGRTDVI
RWWEGSGVTFEHYELVCKVASRYGQVDVLELWRQLKGDDKLSFDIQILTEPTLHSHIDVL
DWWLRYAHGELPGMDGRRAKKVEYRMMDIEEALEDALGDQTEVRRWWAGHGLNLGVGTTE
WMKPMEL
Download sequence
Identical sequences A0A194VZQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]