SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194WY39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194WY39
Domain Number 1 Region: 32-209
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.02e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00035
Further Details:      
 
Domain Number 2 Region: 404-534
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000575
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A194WY39
Sequence length 622
Comment (tr|A0A194WY39|A0A194WY39_9HELO) Phosphopentothenoylcysteine decarboxylase-like protein {ECO:0000313|EMBL:KUJ12512.1} KW=Complete proteome; Reference proteome OX=149040 OS=Phialocephala scopiformis. GN=LY89DRAFT_652987 OC=Helotiales; Helotiales incertae sedis; Phialocephala.
Sequence
MAEHAHSLQARFLHSLPKTSSSSSIADMRVNDPQKLRVLVAANGSKDVAKALALVVRLSK
NPKIETRAIVDEESWPAHRLSQETLALQNRSFRPSQETDEAQKSIERSQVEFYKQQAYEL
CDWADMLVLAPIDADTFAKMLHGITDCLLLEILRGWDVSKKILLVPGMTTAMWENPMTKK
QLSKVRRKWQWVRVMQPILWHYDDKGPSKVLMAWDGFNELVDVIKNQAELMSIGHDVDVA
TAGAATMARHNMQTDALLPPELWTLIFERVGDWEIAKALHVYTSLPVPPEWHDRPNETKD
ELQTFMCSLEWTILTQSTEHIIEKLKGAPKNMRFLSSLCVKLVIKFCLIDILNHLEVNFK
DVFWSSFGQKLLPTKASAVYGRTEILEWWRTSPTFLSKDYTAEAIDGASKSGFVHVLDWW
RRSGLPLKYTESALEQASSKGHIVVLEWWKQASYAHGASTSNDRDGTATPPEVQPALRLK
PGKSLLAAAQNNQALVLRWWDNSGIPISCSESVAKIASAHGHVEVLDAWREIKGEKMQFD
SKVLVEPTKNGHVNVLEWWKNLSRGVDGRAGPKVEYKTCDIEEALEDSIGSEGTAFEVKR
WWAQNGLNLGVGVSEWTKVKIL
Download sequence
Identical sequences A0A194WY39
XP_018066867.1.68874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]