SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A194WYI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194WYI2
Domain Number 1 Region: 266-329
Classification Level Classification E-value
Superfamily XPC-binding domain 8.37e-22
Family XPC-binding domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-20
Family Ubiquitin-related 0.00029
Further Details:      
 
Domain Number 3 Region: 319-388
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000887
Family UBA domain 0.0013
Further Details:      
 
Domain Number 4 Region: 127-189
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000234
Family UBA domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A194WYI2
Sequence length 391
Comment (tr|A0A194WYI2|A0A194WYI2_9HELO) UV excision repair protein Rad23 {ECO:0000313|EMBL:KUJ13026.1} KW=Complete proteome; Reference proteome OX=149040 OS=Phialocephala scopiformis. GN=LY89DRAFT_623137 OC=Helotiales; Helotiales incertae sedis; Phialocephala.
Sequence
MKLTFKDLKQNKFVIDAEPSELISAVKEKIEKEKGWEAAQQKLIYSGKILQDANTVESYK
IEEKGFIVCMIQKPKAAPAASASTSKPPSTPAPASASTPAPPPAPVQSTSTTSALPATPS
PAGAGNAPQAIPSTPSGDTSGLAMGAERTRQITEMVNMGFPRPEVEAAMRAAFYNSERAM
EYLLDGIPENLQQEATPAAPAAQAEASPVPAAATGDAAAEGGDEPLNLFDAAAQAAGGRG
GGAARTGSAANLLAGAGAGAGAAAGGLGNLDFLRNNPQFQQLRQVVQQNPQMLEPILQQV
GAGNPQLAQLIGQHPEQFLQLLSEDGDNDTPLPPGAQAISVTEDERAAIERLCLLGFPRD
LAIQAYFACDKNEELAANFLFDQPDDDDMQQ
Download sequence
Identical sequences A0A194WYI2
XP_018067381.1.68874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]