SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A195CRC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195CRC9
Domain Number 1 Region: 34-74
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000209
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A195CRC9
Sequence length 118
Comment (tr|A0A195CRC9|A0A195CRC9_9HYME) Uncharacterized protein {ECO:0000313|EMBL:KYN02664.1} KW=Complete proteome; Reference proteome OX=456900 OS=Cyphomyrmex costatus. GN=ALC62_06463 OC=Vespoidea; Formicidae; Myrmicinae; Cyphomyrmex.
Sequence
MENYLNSSSKQQETEETSNVHLKNDTVQHIPRNMRDAVSYLKQKGIHDIIDSLLGELLLC
RPHDPYEYLVQLLDRRILTRDGLIDSPPPFCSRDIIRQARQANLLTLLEFTTKGTRKS
Download sequence
Identical sequences A0A195CRC9
XP_018395480.1.22276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]