SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A195EVU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195EVU6
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.75e-33
Family Inhibitor of apoptosis (IAP) repeat 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A195EVU6
Sequence length 131
Comment (tr|A0A195EVU6|A0A195EVU6_9HYME) Baculoviral IAP repeat-containing protein 5 {ECO:0000313|EMBL:KYN32266.1} KW=Complete proteome; Reference proteome OX=34720 OS=Trachymyrmex septentrionalis. GN=ALC56_13645 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
EATSYFWKQSRRTTYGSWPFNESNKCNAERMAAAGFYVVGDSNEPDLVECFICSKQLDGW
EPDDDPWSEHEKHQSSCPFVKLNKQEEKEWTVDELYDLYKKYKTKEYMDQVKKNINTMKD
ITAQLMSELSK
Download sequence
Identical sequences A0A195EVU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]