SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A196S5Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A196S5Q0
Domain Number 1 Region: 11-68
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.11e-17
Family PSF2 N-terminal domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 70-147
Classification Level Classification E-value
Superfamily GINS helical bundle-like 0.00000000000105
Family PSF2 C-terminal domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A196S5Q0
Sequence length 211
Comment (tr|A0A196S5Q0|A0A196S5Q0_BLAHN) DNA replication complex GINS protein PSF2 {ECO:0000313|EMBL:OAO12398.1} KW=Complete proteome; Reference proteome OX=478820 OS=Blastocystis sp. subtype 1 (strain ATCC 50177 / NandII). GN=AV274_5936 OC=Eukaryota; Stramenopiles; Blastocystis.
Sequence
MNASLGKIPLQDFEFFAEDDMIDIVCFSKMEKLHMISGDFGPFEPMEQATVPLWLAIILK
KNNKCRIVMPTWLSVNNLRIALEKDRTMDLNNDPVLYSLPNHYIEISRILLENCEDDIED
AKEVRSLLDIIIKVRESRLNEFKSTVIGYLSSTLEEKFNHGEYREFVKRPFYDIIEGASD
IEVNRLFSQFLPVLEELTKNEDTRKLLLSTM
Download sequence
Identical sequences A0A196S5Q0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]