SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A196SDU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A196SDU3
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 3.53e-19
Family eIF-2-alpha, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A196SDU3
Sequence length 87
Comment (tr|A0A196SDU3|A0A196SDU3_BLAHN) Eukaryotic translation initiation factor 2 alpha subunit {ECO:0000313|EMBL:OAO15225.1} KW=Complete proteome; Reference proteome OX=478820 OS=Blastocystis sp. subtype 1 (strain ATCC 50177 / NandII). GN=AV274_3068 OC=Eukaryota; Stramenopiles; Blastocystis.
Sequence
MPISISLIAPPLYVMTTMALQEREGVELLNKAIAELERVLKENGGAMXVKNEPRVAHKQE
DADLEGLMKKMELENQEVAADDDEDED
Download sequence
Identical sequences A0A196SDU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]