SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A197JAN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A197JAN0
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-22
Family Ubiquitin-related 0.00023
Further Details:      
 
Domain Number 2 Region: 268-334
Classification Level Classification E-value
Superfamily XPC-binding domain 1.31e-21
Family XPC-binding domain 0.00028
Further Details:      
 
Domain Number 3 Region: 137-194
Classification Level Classification E-value
Superfamily UBA-like 9.7e-16
Family UBA domain 0.0016
Further Details:      
 
Domain Number 4 Region: 326-389
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000624
Family UBA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A197JAN0
Sequence length 396
Comment (tr|A0A197JAN0|A0A197JAN0_9FUNG) UV excision repair protein Rad23 {ECO:0000313|EMBL:OAQ22167.1} KW=Complete proteome; Reference proteome OX=1314771 OS=Mortierella elongata AG-77. GN=K457DRAFT_1911829 OC=Mortierellaceae; Mortierella.
Sequence
MQITIKTLKQESFKVEVEESDKVLTIKEKVEQLQGHPVASQKLIFSGKILADENPVSQYN
ITEKDFLVIMVTKPKAAPAPKAAAPATTSTTPAPAAAPAAPTPSAPVAQAPVEATPAAAA
AAPVIGENPTPAVSAEPAPPTSADNALLTGTHFETAIQNMMEMGFPREQCMNAMRASFNN
PDRAVEYLMTGIPDHLQAHASAPAPAAPRAPAAGTAAPANTAATSTPAAAGVASAATTAA
QPQNLFTAAAQAAANARRSAETGGAGDGADSLAFLRDQPQFQQIREMVQQNPELLQPLLV
QLGQTNPHMLQLINQNQQAFLQLLNEGNDGEEGHPPAGANHIYVTQEEQEAIQRLENLGF
DRQTAVEAFLACDRDEQMAANYLFDHGHDDMDEEFQ
Download sequence
Identical sequences A0A197JAN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]