SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A197KFU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A197KFU9
Domain Number 1 Region: 156-288
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 284-407
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-30
Family cAMP-binding domain 0.0000955
Further Details:      
 
Domain Number 3 Region: 15-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A197KFU9
Sequence length 456
Comment (tr|A0A197KFU9|A0A197KFU9_9FUNG) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1314771 OS=Mortierella elongata AG-77. GN=K457DRAFT_131614 OC=Mortierellaceae; Mortierella.
Sequence
MFASSTASQSPIHRSLPQAYAEILNDLNQKVISAQPQDVLQFCANYFNAKLEEQRVRFLA
TARTAPQQNRDIPQFLPAAIPPSLAVSSPNIGSAATPAASSPDHSMESESESDDDEDQEE
PSPLLTMPPNYMRGRRTSVSAESMVPSHQNYVKTVIPKTDEQRRRIEVSISNNFLFKNLD
EDQHEDVVNAMTEKRFQCKDNVIEQGAVGDFFYVVETGTLDVFVAKHGNPAEKVFEYGPG
GSFGELALMYNGPRAATVTATSDVVLWALDRVTFRRILMENTSRKRRMYEAFLETVPLLV
SLEPYERHKIADALESVYFTDGQAVVKQGDQGDNFFIIESGEATVTKCNDEGVEFPMPGL
GPGQYFGELALLNDMPRAATVRAKGRLKCATLGKRAFVRLLGPVVEIIKRNSDNYQTIEQ
QIQQQQLLQEQQQQQQQHQQPQATEGVPPPPPHPQE
Download sequence
Identical sequences A0A197KFU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]