SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A199URJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A199URJ2
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 6.93e-29
Family Tubulin chaperone cofactor A 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A199URJ2
Sequence length 116
Comment (tr|A0A199URJ2|A0A199URJ2_ANACO) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=4615 OS=Ananas comosus (Pineapple) (Ananas ananas). GN=ACMD2_00422 OC=Bromelioideae; Ananas.
Sequence
MLQLEMATIRNLKIKTSTCKRILKELHSYEKEVEREAAKTAEMKEKSADPYDLKQQENVL
AESRMMVPDCRRRLEAALADLKAILEEVKESNQQVVEIEEAGSTITEVEALFQTAE
Download sequence
Identical sequences A0A199URJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]