SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A199W562 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A199W562
Domain Number 1 Region: 76-247
Classification Level Classification E-value
Superfamily eIF4e-like 6.41e-61
Family Translation initiation factor eIF4e 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A199W562
Sequence length 255
Comment (tr|A0A199W562|A0A199W562_ANACO) Eukaryotic translation initiation factor 4E-1 {ECO:0000313|EMBL:OAY84318.1} KW=Complete proteome; Reference proteome OX=4615 OS=Ananas comosus (Pineapple) (Ananas ananas). GN=ACMD2_16695 OC=Bromelioideae; Ananas.
Sequence
MAEETETTTTAAAAAAGVAPEERLRERESGAPPPPRGPEEEEEEEDEEEEEEMEEGEIES
DAMDGGGAGMGMMGAPSQGHPLEHAWTFWFDNPSGKSKQAAWGSSLRPIHTFATVEDFWS
LYNNINHPSKLVVGADFHCFKHKIEPKWEDPICANGGSGQLAVLEEIRHLWCIQYLLAMI
GEQFDYGDEICGAVVSIRGKQERIAVWTKNAANETAQVSIGRQWKELLDYKDTIGFIVHD
DAKKHDKVAKNRYTV
Download sequence
Identical sequences A0A199W562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]