SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A2GDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A2GDB3
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily LigT-like 0.00000000000889
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A2GDB3
Sequence length 168
Comment (tr|A0A1A2GDB3|A0A1A2GDB3_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:OBG27079.1} KW=Complete proteome; Reference proteome OX=1834094 OS=Mycobacterium sp. 852002-51057_SCH5723018. GN=A5764_04120 OC=Mycobacterium.
Sequence
MVHSIELVFDPDTEAAIRHIWEGLAGAGIPSQAPASRPHVTLVVAERIDPDVDELLRPVA
RRLPLRCAVGAPVLFGRASVVFARLIVPTGELLVLHAEVHRLCLPHLAPAPMANSLPGQW
TAHVTLARRVGGHHLGRALRIAGRPSQIDGHFAGLRRWDGNKKVEYLL
Download sequence
Identical sequences A0A1A2GDB3
WP_067112897.1.44175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]