SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A2KE79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A2KE79
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily MbtH-like 3.92e-32
Family MbtH-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A2KE79
Sequence length 76
Comment (tr|A0A1A2KE79|A0A1A2KE79_9MYCO) Protein mbtH {ECO:0000313|EMBL:OBG76656.1} KW=Complete proteome; Reference proteome OX=1834123 OS=Mycobacterium sp. E1214. GN=A5700_21480 OC=Mycobacterium.
Sequence
MSINPFDDDNGSFFVLVNDEEQHSLWPAFADVPAGWRVVFGEADRAACLEYIEEHWPDIR
PKSLRDRLASGRGFDQ
Download sequence
Identical sequences A0A1A2KE79 A0A1A2PQ65
WP_068067615.1.23954 WP_068067615.1.35866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]