SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A2N1B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A2N1B3
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily MbtH-like 1.7e-27
Family MbtH-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A2N1B3
Sequence length 73
Comment (tr|A0A1A2N1B3|A0A1A2N1B3_9MYCO) Protein mbtH {ECO:0000313|EMBL:OBH08919.1} KW=Complete proteome OX=1834128 OS=Mycobacterium sp. E1747. GN=A5695_01855 OC=Mycobacterium.
Sequence
MRLNPFDDESGKFIVLVNNEEQHSLWPVLGDVPAGWRVAYGEAERAACLDYIEQNWPDIS
PKPLRERLSALGL
Download sequence
Identical sequences A0A1A2N1B3
WP_068082891.1.37712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]