SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A2PDN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A2PDN7
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily MbtH-like 2.62e-30
Family MbtH-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A2PDN7
Sequence length 73
Comment (tr|A0A1A2PDN7|A0A1A2PDN7_9MYCO) Protein mbtH {ECO:0000313|EMBL:OBH25458.1} KW=Complete proteome OX=1834147 OS=Mycobacterium sp. E342. GN=A5692_02210 OC=Mycobacterium.
Sequence
MQNNPFDDDSGKFFVLVNNEEQHSLWPVFTDVPPGWRVVYGEADRAACLDYIEQNWPDIR
PKSLRDRLSAPGL
Download sequence
Identical sequences A0A0U1DFQ3 A0A1A2PDN7
WP_068059651.1.31779 WP_068059651.1.72743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]