SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A3N0S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A3N0S3
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily MbtH-like 7.06e-32
Family MbtH-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A3N0S3
Sequence length 76
Comment (tr|A0A1A3N0S3|A0A1A3N0S3_9MYCO) Protein mbtH {ECO:0000313|EMBL:OBK13982.1} KW=Complete proteome OX=1856860 OS=Mycobacterium sp. 1245852.3. GN=A9W96_00915 OC=Mycobacterium.
Sequence
MSINPFDDDNGSFFVLVNDEEQHSLWPAFADVPAGWRVVHGEADRAACLEYIEQHWPDIR
PKSLRDKLATGRGFEQ
Download sequence
Identical sequences A0A1A3DT64 A0A1A3FB08 A0A1A3N0S3
WP_066871596.1.32114 WP_066871596.1.57570 WP_066871596.1.63489 WP_066871596.1.68187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]